Total number of results for Jasus lalandii are 1
Download
as Fasta All
| NPID | Sequence | Length | Organism | Family | Name | PMID | Peptide_REF |
|---|---|---|---|---|---|---|---|
| NP00613 |
RFTFDCPGMMGQRYLYEQVEQVCDDCYNLYREEKIAVNCRENCFLNSWFTVCLQATMREHETPRFDIWR
|
69 | Jasus lalandii | Arthropod CHH/MIH/GIH/VIH hormone | Molt-inhibiting hormone | 11072117#Marco HG, Stoeva S, Voelter W, Gäde G#Characterization and sequence elucidation of a novel peptide with molt-inhibiting activity from the South African spiny lobster, Jasus lalandii#Peptides 2000 Sep;21(9):1313-21 |